Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
Protein Phosphoglucose isomerase, PGI [53702] (8 species) moonlights as neuroleukin, autocrine motility factor, and differentiation mediator |
Species Human (Homo sapiens) [TaxId:9606] [64176] (7 PDB entries) |
Domain d1iria_: 1iri A: [71343] complexed with e4p |
PDB Entry: 1iri (more details), 2.4 Å
SCOPe Domain Sequences for d1iria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iria_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Human (Homo sapiens) [TaxId: 9606]} maaltrdpqfqklqqwyrehrselnlrrlfdankdrfnhfsltlntnhghilvdysknlv tedvmrmlvdlaksrgveaarermfngekinytegravlhvalrnrsntpilvdgkdvmp evnkvldkmksfcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr vwyvsnidgthiaktlaqlnpesslfiiasktfttqetitnaetakewflqaakdpsava khfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga hwmdqhfrttpleknapvllallgiwyincfgcethamlpydqylhrfaayfqqgdmesn gkyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl hhkillanflaqtealmrgksteearkelqaagkspedlerllphkvfegnrptnsivft kltpfmlgalvamyehkifvqgiiwdinsfdqwgvelgkqlakkiepeldgsaqvtshda stnglinfikqqrearv
Timeline for d1iria_: