Lineage for d1imoa_ (1imo A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1836776Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1836777Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 1836790Family c.15.1.2: DNA ligase [52117] (3 proteins)
  6. 1836791Protein DNA ligase III alpha [63958] (1 species)
  7. 1836792Species Human (Homo sapiens) [TaxId:9606] [63959] (2 PDB entries)
  8. 1836793Domain d1imoa_: 1imo A: [62590]

Details for d1imoa_

PDB Entry: 1imo (more details)

PDB Description: nmr structure of human dna ligase iiialpha brct domain
PDB Compounds: (A:) DNA ligase III

SCOPe Domain Sequences for d1imoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imoa_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]}
gsadetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgs
rdknpaaqqvspewiwacirkrrlvapc

SCOPe Domain Coordinates for d1imoa_:

Click to download the PDB-style file with coordinates for d1imoa_.
(The format of our PDB-style files is described here.)

Timeline for d1imoa_: