Lineage for d1imoa_ (1imo A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67929Fold c.15: BRCT domain [52112] (1 superfamily)
  4. 67930Superfamily c.15.1: BRCT domain [52113] (3 families) (S)
  5. 67935Family c.15.1.2: DNA ligase [52117] (2 proteins)
  6. 67936Protein DNA ligase III alpha [63958] (1 species)
  7. 67937Species Human (Homo sapiens) [TaxId:9606] [63959] (2 PDB entries)
  8. 67939Domain d1imoa_: 1imo A: [62590]

Details for d1imoa_

PDB Entry: 1imo (more details)

PDB Description: nmr structure of human dna ligase iiialpha brct domain

SCOP Domain Sequences for d1imoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imoa_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens)}
gsadetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgs
rdknpaaqqvspewiwacirkrrlvapc

SCOP Domain Coordinates for d1imoa_:

Click to download the PDB-style file with coordinates for d1imoa_.
(The format of our PDB-style files is described here.)

Timeline for d1imoa_: