SCOPe 2.08: Domain d1imoa1: 1imo A:837-922

Lineage for d1imoa1 (1imo A:837-922)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.2: DNA ligase [52117] (3 proteins)

6. Protein DNA ligase III alpha [63958] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63959] (2 PDB entries)

8. Domain d1imoa1: 1imo A:837-922 [62590]
   Other proteins in same PDB: d1imoa2

Details for d1imoa1

PDB Entry: 1imo

PDB Description: nmr structure of human dna ligase iiialpha brct domain

PDB Compounds: (A:) DNA ligase III

SCOPe Domain Sequences for d1imoa1:

Sequence; same for both SEQRES and ATOM records:

>d1imoa1 c.15.1.2 (A:837-922) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]}
adetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrd
knpaaqqvspewiwacirkrrlvapc

Timeline for d1imoa1:

• d1imoa1 first appeared in SCOP 1.57, called d1imoa_
  
• d1imoa1 appears in SCOPe 2.07