Lineage for d1ihfb_ (1ihf B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
core: 4 helices; bundle, partly opened, capped with a beta-sheetSuperfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) 
dimer of identical subunits
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
automatically mapped to Pfam PF00216
Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
heterodimer of two related subunitsSpecies Escherichia coli [TaxId:562] [88881] (5 PDB entries) 
Domain d1ihfb_: 1ihf B: [17894]
Other proteins in same PDB: d1ihfa_
protein/DNA complex; complexed with cd
Details for d1ihfb_
PDB Entry: 1ihf (more details), 2.5 Å
PDB Description: integration host factor/dna complex
PDB Compounds: (B:) protein (integration host factor (beta) (ihf))SCOPe Domain Sequences for d1ihfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg
SCOPe Domain Coordinates for d1ihfb_:
Click to download the PDB-style file with coordinates for d1ihfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihfb_:
- d1ihfb_ first appeared (with stable ids) in SCOP 1.55
- d1ihfb_ appears in SCOPe 2.03
- d1ihfb_ appears in SCOPe 2.05
- d1ihfb_ appears in the current release, SCOPe 2.08
View in 3D
