Lineage for d1ihfb_ (1ihf B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4185Fold a.55: Prokaryotic DNA-bending protein [47728] (1 superfamily)
  4. 4186Superfamily a.55.1: Prokaryotic DNA-bending protein [47729] (1 family) (S)
  5. 4187Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 4202Protein Integration host factor (IHF) [47731] (1 species)
  7. 4203Species Escherichia coli [TaxId:562] [47732] (1 PDB entry)
  8. 4205Domain d1ihfb_: 1ihf B: [17894]

Details for d1ihfb_

PDB Entry: 1ihf (more details), 2.5 Å

PDB Description: integration host factor/dna complex

SCOP Domain Sequences for d1ihfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihfb_ a.55.1.1 (B:) Integration host factor (IHF) {Escherichia coli}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

SCOP Domain Coordinates for d1ihfb_:

Click to download the PDB-style file with coordinates for d1ihfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ihfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ihfa_