Lineage for d1iaka2 (1iak A:1-81)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) 
Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries) 
Domain d1iaka2: 1iak A:1-81 [38199]
Other proteins in same PDB: d1iaka1, d1iakb1, d1iakb2
complexed with nag
fragment; missing more than one-third of the common structure and/or sequence
Details for d1iaka2
PDB Entry: 1iak (more details), 1.9 Å
PDB Description: histocompatibility antigen i-ak
PDB Compounds: (A:) MHC class II I-akSCOPe Domain Sequences for d1iaka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaka2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
lqniatgkhnleiltkrsnstp
SCOPe Domain Coordinates for d1iaka2:
Click to download the PDB-style file with coordinates for d1iaka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iaka2:
- d1iaka2 first appeared (with stable ids) in SCOP 1.55
- d1iaka2 appears in SCOPe 2.07
View in 3D
