![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries) |
![]() | Domain d1iakb2: 1iak B:5-92 [38200] Other proteins in same PDB: d1iaka1, d1iaka2, d1iakb1 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1iak (more details), 1.9 Å
SCOPe Domain Sequences for d1iakb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iakb2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]} gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq ylertraeldtvcrhnyektetptslr
Timeline for d1iakb2: