Lineage for d1i9da_ (1i9d A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133575Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2133576Protein Arsenate reductase ArsC [69519] (1 species)
  7. 2133577Species Escherichia coli [TaxId:562] [69520] (4 PDB entries)
  8. 2133580Domain d1i9da_: 1i9d A: [66098]
    complexed with cs, so3, so4

Details for d1i9da_

PDB Entry: 1i9d (more details), 1.65 Å

PDB Description: arsenate reductase from e. coli
PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1i9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9da_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallrkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

SCOPe Domain Coordinates for d1i9da_:

Click to download the PDB-style file with coordinates for d1i9da_.
(The format of our PDB-style files is described here.)

Timeline for d1i9da_: