Lineage for d1i9da_ (1i9d A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.12: Arsenate reductase ArsC [69518] (1 protein) Protein Arsenate reductase ArsC [69519] (1 species) Species Escherichia coli [TaxId:562] [69520] (3 PDB entries) 
Domain d1i9da_: 1i9d A: [66098]
Details for d1i9da_
PDB Entry: 1i9d (more details), 1.65 Å
PDB Description: arsenate reductase from e. coli
SCOP Domain Sequences for d1i9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9da_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallrkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl
SCOP Domain Coordinates for d1i9da_:
Click to download the PDB-style file with coordinates for d1i9da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i9da_:
- d1i9da_ is new in SCOP 1.59
- d1i9da_ appears in SCOP 1.61
- d1i9da_ appears in the current release, SCOPe 2.08
View in 3D