Lineage for d1i7ya_ (1i7y A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077067Protein Phycocyanin alpha subunit [88933] (8 species)
  7. 1077117Species Synechococcus vulcanus [TaxId:32053] [88938] (6 PDB entries)
  8. 1077121Domain d1i7ya_: 1i7y A: [61917]
    Other proteins in same PDB: d1i7yb_
    complexed with cyc, men

Details for d1i7ya_

PDB Entry: 1i7y (more details), 2.5 Å

PDB Description: crystal structure of c-phycocyanin of synechococcus vulcanus at 2.5 angstroms.
PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d1i7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7ya_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d1i7ya_:

Click to download the PDB-style file with coordinates for d1i7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ya_: