Class a: All alpha proteins [46456] (226 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (1 family) |
Family a.21.1.1: HMG-box [47096] (9 proteins) |
Protein High mobility group protein 1, HMG1 [47097] (2 species) duplication: contains HMG-box domains |
Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (4 PDB entries) |
Domain d1hsm__: 1hsm - [16421] domain B complexed with bme |
PDB Entry: 1hsm (more details)
SCOP Domain Sequences for d1hsm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsm__ a.21.1.1 (-) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus)} napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk ekyekdiaayrakgkpdaa
Timeline for d1hsm__: