Lineage for d1hsma_ (1hsm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310163Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2310164Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2310165Family a.21.1.1: HMG-box [47096] (10 protein domains)
  6. 2310166Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 2310167Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47099] (5 PDB entries)
  8. 2310169Domain d1hsma_: 1hsm A: [16421]
    domain B
    complexed with bme

Details for d1hsma_

PDB Entry: 1hsm (more details)

PDB Description: the structure of the hmg box and its interaction with dna
PDB Compounds: (A:) high mobility group protein 1

SCOPe Domain Sequences for d1hsma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa

SCOPe Domain Coordinates for d1hsma_:

Click to download the PDB-style file with coordinates for d1hsma_.
(The format of our PDB-style files is described here.)

Timeline for d1hsma_: