Lineage for d1hsm__ (1hsm -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440137Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 440138Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 440139Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 440140Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 440141Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (4 PDB entries)
  8. 440142Domain d1hsm__: 1hsm - [16421]
    domain B

Details for d1hsm__

PDB Entry: 1hsm (more details)

PDB Description: the structure of the hmg box and its interaction with dna

SCOP Domain Sequences for d1hsm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsm__ a.21.1.1 (-) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus)}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrakgkpdaa

SCOP Domain Coordinates for d1hsm__:

Click to download the PDB-style file with coordinates for d1hsm__.
(The format of our PDB-style files is described here.)

Timeline for d1hsm__: