Lineage for d1hqba_ (1hqb A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731171Family a.28.1.3: apo-D-alanyl carrier protein [63535] (1 protein)
    automatically mapped to Pfam PF00550
  6. 1731172Protein apo-D-alanyl carrier protein [63536] (1 species)
  7. 1731173Species Lactobacillus casei [TaxId:1582] [63537] (2 PDB entries)
  8. 1731174Domain d1hqba_: 1hqb A: [61128]

Details for d1hqba_

PDB Entry: 1hqb (more details)

PDB Description: tertiary structure of apo-d-alanyl carrier protein
PDB Compounds: (A:) apo-d-alanyl carrier protein

SCOPe Domain Sequences for d1hqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqba_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]}
adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
fdrkewdtpnkiiakveqaq

SCOPe Domain Coordinates for d1hqba_:

Click to download the PDB-style file with coordinates for d1hqba_.
(The format of our PDB-style files is described here.)

Timeline for d1hqba_: