PDB entry 1hqb

View 1hqb on RCSB PDB site
Description: tertiary structure of apo-d-alanyl carrier protein
Class: transport protein
Keywords: 3-helix bundle, transport protein
Deposited on 2000-12-14, released 2001-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apo-d-alanyl carrier protein
  Species: Lactobacillus casei [TaxId:1582]
  Gene: DLTC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55153 (0-79)
  Domains in SCOPe 2.05: d1hqba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hqbA (A:)
  adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
  fdrkewdtpnkiiakveqaq