Lineage for d1hnra_ (1hnr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735281Fold a.155: H-NS histone-like proteins [81274] (1 superfamily)
    multihelical oligomeric protein; structure of whole subunit is not known yet but are probably composed of three different domains
  4. 2735282Superfamily a.155.1: H-NS histone-like proteins [81273] (1 family) (S)
    available NMR structures suggest two very different dimerisation modes of the N-terminal domain
  5. 2735283Family a.155.1.1: H-NS histone-like proteins [81272] (3 proteins)
  6. 2735288Protein H1 protein (H-NS) [47733] (1 species)
  7. 2735289Species Escherichia coli [TaxId:562] [47734] (4 PDB entries)
  8. 2735292Domain d1hnra_: 1hnr A: [17896]
    C-terminal DNA-binding domain; res. 90-136

Details for d1hnra_

PDB Entry: 1hnr (more details)

PDB Description: h-ns (dna-binding domain)
PDB Compounds: (A:) h-ns

SCOPe Domain Sequences for d1hnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnra_ a.155.1.1 (A:) H1 protein (H-NS) {Escherichia coli [TaxId: 562]}
aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq

SCOPe Domain Coordinates for d1hnra_:

Click to download the PDB-style file with coordinates for d1hnra_.
(The format of our PDB-style files is described here.)

Timeline for d1hnra_: