PDB entry 1hnr

View 1hnr on RCSB PDB site
Description: h-ns (DNA-binding domain)
Class: DNA-binding protein
Keywords: histone-like protein h1, DNA-binding protein
Deposited on 1995-04-06, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-ns
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACF8 (0-46)
  Domains in SCOPe 2.08: d1hnra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hnrA (A:)
  aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq