Lineage for d1h3za_ (1h3z A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537450Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 1537467Protein Hypothetical protein SPBC215.07c [89297] (1 species)
  7. 1537468Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [89298] (1 PDB entry)
  8. 1537469Domain d1h3za_: 1h3z A: [83471]

Details for d1h3za_

PDB Entry: 1h3z (more details)

PDB Description: solution structure of a pwwp domain from schizosaccharomyces pombe
PDB Compounds: (A:) hypothetical 62.8 kda protein c215.07c

SCOPe Domain Sequences for d1h3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
servnykpgmrvltkmsgfpwwpsmvvteskmtsvarkskpkragtfypviffpnkeylw
tgsdsltpltseaisqflekpkpktaslikaykmaqstpdldslsvps

SCOPe Domain Coordinates for d1h3za_:

Click to download the PDB-style file with coordinates for d1h3za_.
(The format of our PDB-style files is described here.)

Timeline for d1h3za_: