Lineage for d1h3za_ (1h3z A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 296055Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 296061Family b.34.9.2: PWWP domain [69250] (2 proteins)
    includes the C-terminal all-alpha subdomain
  6. 296065Protein Hypothetical protein SPBC215.07c [89297] (1 species)
  7. 296066Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [89298] (1 PDB entry)
  8. 296067Domain d1h3za_: 1h3z A: [83471]

Details for d1h3za_

PDB Entry: 1h3z (more details)

PDB Description: solution structure of a pwwp domain from schizosaccharomyces pombe

SCOP Domain Sequences for d1h3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe)}
servnykpgmrvltkmsgfpwwpsmvvteskmtsvarkskpkragtfypviffpnkeylw
tgsdsltpltseaisqflekpkpktaslikaykmaqstpdldslsvps

SCOP Domain Coordinates for d1h3za_:

Click to download the PDB-style file with coordinates for d1h3za_.
(The format of our PDB-style files is described here.)

Timeline for d1h3za_: