| Class b: All beta proteins [48724] (126 folds) |
| Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) ![]() |
| Family b.34.9.2: PWWP domain [69250] (2 proteins) includes the C-terminal all-alpha subdomain |
| Protein Hypothetical protein SPBC215.07c [89297] (1 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [89298] (1 PDB entry) |
| Domain d1h3za_: 1h3z A: [83471] |
PDB Entry: 1h3z (more details)
SCOP Domain Sequences for d1h3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe)}
servnykpgmrvltkmsgfpwwpsmvvteskmtsvarkskpkragtfypviffpnkeylw
tgsdsltpltseaisqflekpkpktaslikaykmaqstpdldslsvps
Timeline for d1h3za_: