Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (19 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry) endoxylanase 11a |
Domain d1h1aa_: 1h1a A: [83450] complexed with ca, gol, so4, unx |
PDB Entry: 1h1a (more details), 1.75 Å
SCOPe Domain Sequences for d1h1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1aa_ b.29.1.11 (A:) Xylanase II {Chaetomium thermophilum [TaxId: 209285]} etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy yssgsatvnvg
Timeline for d1h1aa_: