Lineage for d1h1aa_ (1h1a A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295061Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 295092Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 295127Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry)
    endoxylanase 11a
  8. 295128Domain d1h1aa_: 1h1a A: [83450]

Details for d1h1aa_

PDB Entry: 1h1a (more details), 1.75 Å

PDB Description: thermophilic beta-1,4-xylanase from chaetomium thermophilum

SCOP Domain Sequences for d1h1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1aa_ b.29.1.11 (A:) Xylanase II {Chaetomium thermophilum}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

SCOP Domain Coordinates for d1h1aa_:

Click to download the PDB-style file with coordinates for d1h1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1h1aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h1ab_