| Class b: All beta proteins [48724] (126 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
| Protein Xylanase II [49979] (15 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry) endoxylanase 11a |
| Domain d1h1aa_: 1h1a A: [83450] |
PDB Entry: 1h1a (more details), 1.75 Å
SCOP Domain Sequences for d1h1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1aa_ b.29.1.11 (A:) Xylanase II {Chaetomium thermophilum}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg
Timeline for d1h1aa_: