Lineage for d1gyca1 (1gyc A:1-130)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1774855Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 1774935Species Trametes versicolor, laccase 2 [TaxId:5325] [74872] (1 PDB entry)
  8. 1774936Domain d1gyca1: 1gyc A:1-130 [70748]
    complexed with cu, ipa, nag

Details for d1gyca1

PDB Entry: 1gyc (more details), 1.9 Å

PDB Description: crystal structure determination at room temperature of a laccase from trametes versicolor in its oxidised form containing a full complement of copper ions
PDB Compounds: (A:) laccase 2

SCOPe Domain Sequences for d1gyca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]}
aigpaaslvvanapvspdgflrdaivvngvfpsplitgkkgdrfqlnvvdtltnhtmlks
tsihwhgffqagtnwadgpafvnqcpiasghsflydfhvpdqagtfwyhshlstqycdgl
rgpfvvydpk

SCOPe Domain Coordinates for d1gyca1:

Click to download the PDB-style file with coordinates for d1gyca1.
(The format of our PDB-style files is described here.)

Timeline for d1gyca1: