Lineage for d1gyca1 (1gyc A:1-130)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) 
Protein Laccase [49557] (4 species) 
Species Trametes versicolor, laccase 2 [TaxId:5325] [74872] (1 PDB entry) 
Domain d1gyca1: 1gyc A:1-130 [70748]
Details for d1gyca1
PDB Entry: 1gyc (more details), 1.9 Å
PDB Description: crystal structure determination at room temperature of a laccase from trametes versicolor in its oxidised form containing a full complement of copper ions
SCOP Domain Sequences for d1gyca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2}
aigpaaslvvanapvspdgflrdaivvngvfpsplitgkkgdrfqlnvvdtltnhtmlks
tsihwhgffqagtnwadgpafvnqcpiasghsflydfhvpdqagtfwyhshlstqycdgl
rgpfvvydpk
SCOP Domain Coordinates for d1gyca1:
Click to download the PDB-style file with coordinates for d1gyca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gyca1:
- d1gyca1 is new in SCOP 1.61
- d1gyca1 appears in SCOP 1.63
- d1gyca1 appears in the current release, SCOPe 2.08
View in 3D
