![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, C-terminal domain [418907] (5 species) |
![]() | Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries) |
![]() | Domain d1gw0a3: 1gw0 A:344-559 [70625] Other proteins in same PDB: d1gw0a1, d1gw0a2, d1gw0b1, d1gw0b2 complexed with cl, cu, nag, oxy, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gw0 (more details), 2.4 Å
SCOPe Domain Sequences for d1gw0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw0a3 b.6.1.3 (A:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsgl
Timeline for d1gw0a3: