Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries) |
Domain d1gq4a_: 1gq4 A: [70340] first PDZ domain complexed with cl |
PDB Entry: 1gq4 (more details), 1.9 Å
SCOPe Domain Sequences for d1gq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gq4a_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} mlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenvek ethqqvvsriraalnavrllvvdpendsll
Timeline for d1gq4a_: