SCOPe 2.08: Domain d1gq4a1: 1gq4 A:11-99

Lineage for d1gq4a1 (1gq4 A:11-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries)

8. Domain d1gq4a1: 1gq4 A:11-99 [70340]
   Other proteins in same PDB: d1gq4a2
   first PDZ domain
   complexed with cl

Details for d1gq4a1

PDB Entry: 1gq4, 1.9 Å

PDB Description: structural determinants of the nherf interaction with beta2ar and pdgfr

PDB Compounds: (A:) ezrin-radixin-moesin binding phosphoprotein-50

SCOPe Domain Sequences for d1gq4a1:

Sequence; same for both SEQRES and ATOM records:

>d1gq4a1 b.36.1.1 (A:11-99) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpendsll

Timeline for d1gq4a1:

• d1gq4a1 first appeared in SCOP 1.61, called d1gq4a_
  
• d1gq4a1 was called d1gq4a_ in SCOPe 2.07