Lineage for d1ftra1 (1ftr A:1-148)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) 
duplication: contains two subdomains of this foldFamily d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries) 
Domain d1ftra1: 1ftr A:1-148 [39485]
Details for d1ftra1
PDB Entry: 1ftr (more details), 1.7 Å
PDB Description: formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
PDB Compounds: (A:) formylmethanofuran:tetrahydromethanopterin formyltransferaseSCOPe Domain Sequences for d1ftra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftra1 d.58.33.1 (A:1-148) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]}
meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
gyklsffgdgyqeedeldgrkvwkipvv
SCOPe Domain Coordinates for d1ftra1:
Click to download the PDB-style file with coordinates for d1ftra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ftra1:
- d1ftra1 first appeared (with stable ids) in SCOP 1.55
- d1ftra1 appears in SCOPe 2.07
View in 3D
