Lineage for d1fs1a1 (1fs1 A:109-149)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735529Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 2735530Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 2735531Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 2735546Protein Skp2 [81379] (1 species)
  7. 2735547Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)
  8. 2735548Domain d1fs1a1: 1fs1 A:109-149 [19250]
    Other proteins in same PDB: d1fs1b1, d1fs1b2, d1fs1d1, d1fs1d2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1fs1a1

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (A:) cyclin a/cdk2-associated p19

SCOPe Domain Sequences for d1fs1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw

SCOPe Domain Coordinates for d1fs1a1:

Click to download the PDB-style file with coordinates for d1fs1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fs1a1: