![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
![]() | Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) ![]() automatically mapped to Pfam PF01198 |
![]() | Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
![]() | Protein Ribosomal protein L31e [54577] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffku_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffku_ d.29.1.1 (U:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]} dfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargr antpskirvraarfeeegeaiveae
Timeline for d1ffku_:
![]() Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |