SCOPe 2.04: Domain d1ffkz_: 1ffk Z:

Lineage for d1ffkz_ (1ffk Z:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1ffkz_: 1ffk Z: [45317]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_
   complexed with cd, k, mg

Details for d1ffkz_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (Z:) ribosomal protein l44e

SCOPe Domain Sequences for d1ffkz_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkz_ g.41.8.3 (Z:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1ffkz_:

• d1ffkz_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkz_ appears in SCOPe 2.03
  
• d1ffkz_ appears in SCOPe 2.05
  
• d1ffkz_ appears in the current release, SCOPe 2.08