Lineage for d1f9ma_ (1f9m A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (16 species) 
Species Spinach (Spinacia oleracea), thioredoxin F [TaxId:3562] [52840] (2 PDB entries) 
Domain d1f9ma_: 1f9m A: [32736]
short form
Details for d1f9ma_
PDB Entry: 1f9m (more details), 1.86 Å
PDB Description: crystal structure of thioredoxin f from spinach chloroplast (short form)
PDB Compounds: (A:) thioredoxin fSCOPe Domain Sequences for d1f9ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]}
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars
SCOPe Domain Coordinates for d1f9ma_:
Click to download the PDB-style file with coordinates for d1f9ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f9ma_:
- d1f9ma_ first appeared (with stable ids) in SCOP 1.55
- d1f9ma_ appears in SCOPe 2.07
View in 3D
