PDB entry 1f9m

View 1f9m on RCSB PDB site
Description: crystal structure of thioredoxin f from spinach chloroplast (short form)
Class: electron transport
Keywords: electron transport
Deposited on 2000-07-11, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin f
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f9ma_
  • Chain 'B':
    Compound: thioredoxin f
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f9mb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9mA (A:)
    meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
    kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9mB (B:)
    meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
    kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars