PDB entry 1f9m
View 1f9m on RCSB PDB site
Description: crystal structure of thioredoxin f from spinach chloroplast (short form)
Class: electron transport
Keywords: electron transport
Deposited on
2000-07-11, released
2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: thioredoxin f
Species: Spinacia oleracea [TaxId:3562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1f9ma_ - Chain 'B':
Compound: thioredoxin f
Species: Spinacia oleracea [TaxId:3562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1f9mb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f9mA (A:)
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f9mB (B:)
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars