Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
Species Vibrio harveyi [TaxId:669] [53730] (4 PDB entries) |
Domain d1ez0a_: 1ez0 A: [35385] complexed with nap |
PDB Entry: 1ez0 (more details), 2.1 Å
SCOPe Domain Sequences for d1ez0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} tdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtiase learsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptrap lpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqiv aecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlaher pepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpetq afietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvts senwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqlip rleeiagrlvfngwptgvevgyamvhggpypasthsastsvgaeaihrwlrpvayqalpe sllpdslkaenpleiaravdgkaa
Timeline for d1ez0a_: