Lineage for d1ez0a_ (1ez0 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27618Fold c.82: Aldehyde reductase (dehydrogenase), ALDH [53719] (1 superfamily)
  4. 27619Superfamily c.82.1: Aldehyde reductase (dehydrogenase), ALDH [53720] (1 family) (S)
  5. 27620Family c.82.1.1: Aldehyde reductase (dehydrogenase), ALDH [53721] (1 protein)
  6. 27621Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (8 species)
  7. 27679Species Vibrio harveyi [TaxId:669] [53730] (2 PDB entries)
  8. 27680Domain d1ez0a_: 1ez0 A: [35385]

Details for d1ez0a_

PDB Entry: 1ez0 (more details), 2.1 Å

PDB Description: crystal structure of the nadp+ dependent aldehyde dehydrogenase from vibrio harveyi.

SCOP Domain Sequences for d1ez0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi}
tdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtiase
learsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptrap
lpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqiv
aecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlaher
pepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpetq
afietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvts
senwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqlip
rleeiagrlvfngwptgvevgyamvhggpypasthsastsvgaeaihrwlrpvayqalpe
sllpdslkaenpleiaravdgkaa

SCOP Domain Coordinates for d1ez0a_:

Click to download the PDB-style file with coordinates for d1ez0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ez0a_: