Lineage for d1exia1 (1exi A:3-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696385Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 2696391Protein Transcription activator BmrR [46963] (1 species)
    followed by long alpha-helical linker
  7. 2696392Species Bacillus subtilis [TaxId:1423] [46964] (4 PDB entries)
    Uniprot P39075
  8. 2696396Domain d1exia1: 1exi A:3-120 [16310]
    Other proteins in same PDB: d1exia2
    protein/DNA complex; complexed with 118, zn

Details for d1exia1

PDB Entry: 1exi (more details), 3.12 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1exia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exia1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

SCOPe Domain Coordinates for d1exia1:

Click to download the PDB-style file with coordinates for d1exia1.
(The format of our PDB-style files is described here.)

Timeline for d1exia1:

2696396
d1exia1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1exia2