PDB entry 1exi

View 1exi on RCSB PDB site
Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpsb
Class: Transcription/DNA
Keywords: Protein-DNA complex, MerR-family transcription activator, multidrug-binding protein, Transcription-DNA COMPLEX
Deposited on 2000-05-02, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multidrug-efflux transporter regulator
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exia1, d1exia2
  • Chain 'M':
    Compound: DNA (5'-d(*ap*cp*cp*cp*tp*cp*cp*cp*cp*tp*tp*ap*gp*gp*gp*gp*ap*gp*gp*gp*t)-3')
  • Heterogens: ZN, 118, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exiA (A:)
    mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk
    yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
    lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
    sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
    adrqltvvsdvyeliipihyspkkqeeyrvemkiriae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exiA (A:)
    esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
    gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypalg
    evfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpytsi
    demtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyiad
    rqltvvsdvyeliipihyspkkqeeyrvemkiria
    

  • Chain 'M':
    No sequence available.