Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein ssDNA-binding protein [50264] (4 species) |
Species Escherichia coli [TaxId:562] [50266] (6 PDB entries) Uniprot P02339 |
Domain d1eqqa_: 1eqq A: [90461] complexed with ssDNA protein/DNA complex; protein/RNA complex |
PDB Entry: 1eqq (more details), 3.2 Å
SCOPe Domain Sequences for d1eqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqqa_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlgg
Timeline for d1eqqa_: