Lineage for d1ekbb_ (1ekb B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795519Protein Enteropeptidase (enterokinase light chain) [50540] (1 species)
  7. 2795520Species Cow (Bos taurus) [TaxId:9913] [50541] (1 PDB entry)
  8. 2795521Domain d1ekbb_: 1ekb B: [26282]
    complexed with zn

Details for d1ekbb_

PDB Entry: 1ekb (more details), 2.3 Å

PDB Description: the serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
PDB Compounds: (B:) enteropeptidase

SCOPe Domain Sequences for d1ekbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]}
ivggsdsregawpwvvalyfddqqvcgaslvsrdwlvsaahcvygrnmepskwkavlglh
masnltspqietrlidqivinphynkrrknndiammhlemkvnytdyiqpiclpeenqvf
ppgricsiagwgaliyqgstadvlqeadvpllsnekcqqqmpeynitenmvcagyeaggv
dscqgdsggplmcqennrwllagvtsfgyqcalpnrpgvyarvprftewiqsflh

SCOPe Domain Coordinates for d1ekbb_:

Click to download the PDB-style file with coordinates for d1ekbb_.
(The format of our PDB-style files is described here.)

Timeline for d1ekbb_: