PDB entry 1ekb

View 1ekb on RCSB PDB site
Description: the serine protease domain of enteropeptidase bound to inhibitor val-asp-asp-asp-asp-lys-chloromethane
Class: hydrolase/hydrolase inhibitor
Keywords: enteropeptidase, trypsinogen activation, hydrolase-hydrolase inhibitor complex
Deposited on 1999-05-02, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: enteropeptidase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98072 (0-End)
• Chain 'B':
  Compound: enteropeptidase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98072 (0-234)
  Domains in SCOPe 2.08: d1ekbb_
• Chain 'C':
  Compound: val-asp-asp-asp-asp-lyk peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 1EKB (2-6)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ekbB (B:)
  ivggsdsregawpwvvalyfddqqvcgaslvsrdwlvsaahcvygrnmepskwkavlglh
  masnltspqietrlidqivinphynkrrknndiammhlemkvnytdyiqpiclpeenqvf
  ppgricsiagwgaliyqgstadvlqeadvpllsnekcqqqmpeynitenmvcagyeaggv
  dscqgdsggplmcqennrwllagvtsfgyqcalpnrpgvyarvprftewiqsflh
  

  
  
• Chain 'C':
  No sequence available.