Lineage for d1ehia2 (1ehi A:135-362)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) 
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (3 proteins) 
Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species) Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [56066] (1 PDB entry) 
Domain d1ehia2: 1ehi A:135-362 [41484]
Other proteins in same PDB: d1ehia1, d1ehib1
complexed with adp, mg, phy
Details for d1ehia2
PDB Entry: 1ehi (more details), 2.38 Å
PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (A:) d-alanine:d-lactate ligaseSCOPe Domain Sequences for d1ehia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvpnqgsgdgw
ydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgearmdflldennvpyl
gepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkkls
SCOPe Domain Coordinates for d1ehia2:
Click to download the PDB-style file with coordinates for d1ehia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehia2:
- d1ehia2 first appeared (with stable ids) in SCOP 1.55
- d1ehia2 appears in SCOPe 2.03
- d1ehia2 appears in SCOPe 2.05
- d1ehia2 appears in the current release, SCOPe 2.08
View in 3D
