Lineage for d1ehia2 (1ehi A:135-362)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541370Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)
  6. 2541376Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species)
  7. 2541380Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [56066] (1 PDB entry)
  8. 2541381Domain d1ehia2: 1ehi A:135-362 [41484]
    Other proteins in same PDB: d1ehia1, d1ehib1
    complexed with adp, mg, phy

Details for d1ehia2

PDB Entry: 1ehi (more details), 2.38 Å

PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (A:) d-alanine:d-lactate ligase

SCOPe Domain Sequences for d1ehia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
dkaltkelltvngirntkyivvdpesannwswdkivaelgnivfvkaanqgssvgisrvt
naeeytealsdsfqydykvlieeavngarelevgvigndqplvseigahtvpnqgsgdgw
ydynnkfvdnsavhfqipaqlspevtkevkqmaldaykvlnlrgearmdflldennvpyl
gepntlpgftnmslfkrlwdysdinnaklvdmlidygfedfaqnkkls

SCOPe Domain Coordinates for d1ehia2:

Click to download the PDB-style file with coordinates for d1ehia2.
(The format of our PDB-style files is described here.)

Timeline for d1ehia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehia1