Lineage for d1ec7a1 (1ec7 A:138-446)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445529Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2445546Protein D-glucarate dehydratase [51610] (2 species)
  7. 2445547Species Escherichia coli [TaxId:562] [51612] (7 PDB entries)
  8. 2445550Domain d1ec7a1: 1ec7 A:138-446 [29218]
    Other proteins in same PDB: d1ec7a2, d1ec7b2, d1ec7c2, d1ec7d2
    complexed with ipa, mg

Details for d1ec7a1

PDB Entry: 1ec7 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase native enzyme
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d1ec7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec7a1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

SCOPe Domain Coordinates for d1ec7a1:

Click to download the PDB-style file with coordinates for d1ec7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ec7a1: