Lineage for d1ec7a1 (1ec7 A:138-446)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19368Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 19390Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 19396Protein D-glucarate dehydratase [51610] (2 species)
  7. 19397Species Escherichia coli [TaxId:562] [51612] (4 PDB entries)
  8. 19398Domain d1ec7a1: 1ec7 A:138-446 [29218]
    Other proteins in same PDB: d1ec7a2, d1ec7b2, d1ec7c2, d1ec7d2

Details for d1ec7a1

PDB Entry: 1ec7 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase native enzyme

SCOP Domain Sequences for d1ec7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec7a1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

SCOP Domain Coordinates for d1ec7a1:

Click to download the PDB-style file with coordinates for d1ec7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ec7a1: