Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (14 proteins) |
Protein Sphericase [75224] (1 species) |
Species Bacillus sphaericus [TaxId:1421] [75225] (1 PDB entry) |
Domain d1ea7a_: 1ea7 A: [70086] complexed with ca |
PDB Entry: 1ea7 (more details), 0.93 Å
SCOPe Domain Sequences for d1ea7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea7a_ c.41.1.1 (A:) Sphericase {Bacillus sphaericus [TaxId: 1421]} rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy asgfgfarvq
Timeline for d1ea7a_: