Lineage for d1ea7a_ (1ea7 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481297Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2481298Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2481299Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2481489Protein Sphericase [75224] (1 species)
  7. 2481490Species Bacillus sphaericus [TaxId:1421] [75225] (1 PDB entry)
  8. 2481491Domain d1ea7a_: 1ea7 A: [70086]
    complexed with ca

Details for d1ea7a_

PDB Entry: 1ea7 (more details), 0.93 Å

PDB Description: sphericase
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d1ea7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea7a_ c.41.1.1 (A:) Sphericase {Bacillus sphaericus [TaxId: 1421]}
rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
asgfgfarvq

SCOPe Domain Coordinates for d1ea7a_:

Click to download the PDB-style file with coordinates for d1ea7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ea7a_: