Lineage for d1dxrh2 (1dxr H:1-36)
- Root: SCOPe 2.01
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
not a true fold
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) 
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) 
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (11 PDB entries)
synonym: blastochloris viridis
Domain d1dxrh2: 1dxr H:1-36 [43433]
Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrl_, d1dxrm_
complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant
Details for d1dxrh2
PDB Entry: 1dxr (more details), 2 Å
PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)
PDB Compounds: (H:) Photosynthetic reaction center H subunitSCOPe Domain Sequences for d1dxrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxrh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred
SCOPe Domain Coordinates for d1dxrh2:
Click to download the PDB-style file with coordinates for d1dxrh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dxrh2:
- d1dxrh2 first appeared (with stable ids) in SCOP 1.55
- d1dxrh2 appears in SCOP 1.75
- d1dxrh2 appears in SCOPe 2.02
- d1dxrh2 appears in the current release, SCOPe 2.08
View in 3D
