| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) ![]() |
| Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
| Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries) synonym: blastochloris viridis |
| Domain d1dxrh2: 1dxr H:1-36 [43433] Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrl_, d1dxrm_ complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant |
PDB Entry: 1dxr (more details), 2 Å
SCOPe Domain Sequences for d1dxrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxrh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d1dxrh2: