Lineage for d1dxrh2 (1dxr H:1-36)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025632Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 3025633Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 3025634Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 3025733Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
    synonym: blastochloris viridis
  8. 3025745Domain d1dxrh2: 1dxr H:1-36 [43433]
    Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrl_, d1dxrm_
    complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrh2

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d1dxrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d1dxrh2:

Click to download the PDB-style file with coordinates for d1dxrh2.
(The format of our PDB-style files is described here.)

Timeline for d1dxrh2: