| Class g: Small proteins [56992] (91 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Thrombomodulin, different EGF-like domains [57225] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries) |
| Domain d1dx5i1: 1dx5 I:345-387 [44302] Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4 complexed with ca, fmt, na, ndg |
PDB Entry: 1dx5 (more details), 2.3 Å
SCOPe Domain Sequences for d1dx5i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcq
Timeline for d1dx5i1: