Lineage for d1dx5.2 (1dx5 B:,N:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546204Protein Thrombin [50531] (2 species)
  7. 1546240Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 1546363Domain d1dx5.2: 1dx5 B:,N: [26156]
    Other proteins in same PDB: d1dx5i1, d1dx5i2, d1dx5i3, d1dx5j1, d1dx5j2, d1dx5j3, d1dx5k1, d1dx5k2, d1dx5k3, d1dx5l1, d1dx5l2, d1dx5l3
    complexed with ca, fmt, na, ndg

Details for d1dx5.2

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex
PDB Compounds: (B:) Thrombin light chain, (N:) Thrombin heavy chain

SCOPe Domain Sequences for d1dx5.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dx5.2 b.47.1.2 (B:,N:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d1dx5.2:

Click to download the PDB-style file with coordinates for d1dx5.2.
(The format of our PDB-style files is described here.)

Timeline for d1dx5.2: